Lineage for d1jkka_ (1jkk A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2586062Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2586063Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2586210Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2587485Protein Death-associated protein kinase, Dap [75560] (1 species)
    CaMK group; CAMKI subfamily; serine/threonine kinase
  7. 2587486Species Human (Homo sapiens) [TaxId:9606] [75561] (31 PDB entries)
    Uniprot P53355 2-285
  8. 2587510Domain d1jkka_: 1jkk A: [71708]
    complexed with anp, mg

Details for d1jkka_

PDB Entry: 1jkk (more details), 2.4 Å

PDB Description: 2.4a x-ray structure of ternary complex of a catalytic domain of death-associated protein kinase with atp analogue and mg.
PDB Compounds: (A:) death-associated protein kinase

SCOPe Domain Sequences for d1jkka_:

Sequence, based on SEQRES records: (download)

>d1jkka_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]}
tvfrqenvddyydtgeelgsgqfavvkkcrekstglqyaakfikkrrtkssrrgvsredi
erevsilkeiqhpnvitlhevyenktdvililelvaggelfdflaekeslteeeateflk
qilngvyylhslqiahfdlkpenimlldrnvpkprikiidfglahkidfgnefknifgtp
efvapeivnyeplgleadmwsigvityillsgaspflgdtkqetlanvsavnyefedeyf
sntsalakdfirrllvkdpkkrmtiqdslqhpwikpkdtqqalssawshpqf

Sequence, based on observed residues (ATOM records): (download)

>d1jkka_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]}
tvfrqenvddyydtgeelgsgqfavvkkcrekstglqyaakfikkrrtkssrrgvsredi
erevsilkeiqhpnvitlhevyenktdvililelvaggelfdflaekeslteeeateflk
qilngvyylhslqiahfdlkpenimlldrnvpkprikiidfglahkidfgnefknifgtp
efvapeivnyeplgleadmwsigvityillsgaspflgdtkqetlanvsavnyefedeyf
sntsalakdfirrllvkdpkkrmtiqdslqhpwikpf

SCOPe Domain Coordinates for d1jkka_:

Click to download the PDB-style file with coordinates for d1jkka_.
(The format of our PDB-style files is described here.)

Timeline for d1jkka_: