SCOP 1.69: Domain d1ji1b2: 1ji1 B:555-637

Lineage for d1ji1b2 (1ji1 B:555-637)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (3 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (21 proteins)
   this domain follows the catalytic beta/alpha barrel domain

6. Protein Maltogenic amylase [51031] (4 species)

7. Species Thermoactinomyces vulgaris, TVAI [TaxId:2026] [75017] (6 PDB entries)

8. Domain d1ji1b2: 1ji1 B:555-637 [71670]
   Other proteins in same PDB: d1ji1a1, d1ji1a3, d1ji1b1, d1ji1b3

Details for d1ji1b2

PDB Entry: 1ji1, 1.6 Å

PDB Description: Crystal Structure Analysis of Thermoactinomyces vulgaris R-47 alpha-Amylase 1

SCOP Domain Sequences for d1ji1b2:

Sequence; same for both SEQRES and ATOM records:

>d1ji1b2 b.71.1.1 (B:555-637) Maltogenic amylase {Thermoactinomyces vulgaris, TVAI}
sfmtlitddtnkiysygrfdnvnriavvlnndsvshtvnvpvwqlsmpngstvtdkitgh
sytvqngmvtvavdghygavlaq

Timeline for d1ji1b2:

• d1ji1b2 first appeared in SCOP 1.61
  
• d1ji1b2 appears in SCOP 1.67
  
• d1ji1b2 appears in SCOP 1.71
  
• d1ji1b2 appears in the current release, SCOPe 2.08