Lineage for d1ji1b2 (1ji1 B:555-637)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2810331Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 2810332Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 2810333Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
    this domain follows the catalytic beta/alpha barrel domain
  6. 2810619Protein Maltogenic amylase [51031] (4 species)
  7. 2810623Species Thermoactinomyces vulgaris, TVAI [TaxId:2026] [75017] (8 PDB entries)
  8. 2810625Domain d1ji1b2: 1ji1 B:555-637 [71670]
    Other proteins in same PDB: d1ji1a1, d1ji1a3, d1ji1b1, d1ji1b3
    complexed with ca

Details for d1ji1b2

PDB Entry: 1ji1 (more details), 1.6 Å

PDB Description: Crystal Structure Analysis of Thermoactinomyces vulgaris R-47 alpha-Amylase 1
PDB Compounds: (B:) alpha-amylase I

SCOPe Domain Sequences for d1ji1b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ji1b2 b.71.1.1 (B:555-637) Maltogenic amylase {Thermoactinomyces vulgaris, TVAI [TaxId: 2026]}
sfmtlitddtnkiysygrfdnvnriavvlnndsvshtvnvpvwqlsmpngstvtdkitgh
sytvqngmvtvavdghygavlaq

SCOPe Domain Coordinates for d1ji1b2:

Click to download the PDB-style file with coordinates for d1ji1b2.
(The format of our PDB-style files is described here.)

Timeline for d1ji1b2: