Lineage for d1jfna_ (1jfn A:)
- Root: SCOP 1.61
Class g: Small proteins [56992] (59 folds) 
Fold g.14: Kringle-like [57439] (1 superfamily) Superfamily g.14.1: Kringle-like [57440] (2 families) 
Family g.14.1.1: Kringle modules [57441] (6 proteins) Protein Apolipoprotein A [57455] (3 species) 
Species Human (Homo sapiens), IV-6 variant [TaxId:9606] [75673] (1 PDB entry) 
Domain d1jfna_: 1jfn A: [71660]
Details for d1jfna_
PDB Entry: 1jfn (more details)
PDB Description: solution structure of human apolipoprotein(a) kringle iv type 6
SCOP Domain Sequences for d1jfna_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jfna_ g.14.1.1 (A:) Apolipoprotein A {Human (Homo sapiens), IV-6 variant}
arihhhhhhiegrapteqspgvqdcyhgdgqsyrgsfsttvtgrtcqswssmtphwhqrt
teyypnggltrnycrnpdaeispwcytmdpnvrweycnltqcpvtessvlatstavseq
SCOP Domain Coordinates for d1jfna_:
Click to download the PDB-style file with coordinates for d1jfna_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1jfna_:
- d1jfna_ is new in SCOP 1.61
- d1jfna_ appears in SCOP 1.63
- d1jfna_ appears in the current release, SCOPe 2.08, called d1jfna1
View in 3D