Lineage for d1jf6a3 (1jf6 A:121-502)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2829819Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 2830199Protein Maltogenic amylase, central domain [51465] (4 species)
    contains an additional N-terminal domain
  7. 2830213Species Thermoactinomyces vulgaris, TVAII [TaxId:2026] [51467] (12 PDB entries)
  8. 2830224Domain d1jf6a3: 1jf6 A:121-502 [71652]
    Other proteins in same PDB: d1jf6a1, d1jf6a2, d1jf6b1, d1jf6b2
    complexed with ca; mutant
    has additional subdomain(s) that are not in the common domain

Details for d1jf6a3

PDB Entry: 1jf6 (more details), 3.2 Å

PDB Description: crystal structure of thermoactinomyces vulgaris r-47 alpha-amylase mutant f286y
PDB Compounds: (A:) alpha amylase II

SCOPe Domain Sequences for d1jf6a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jf6a3 c.1.8.1 (A:121-502) Maltogenic amylase, central domain {Thermoactinomyces vulgaris, TVAII [TaxId: 2026]}
vfttpewakeaviyqifperfangdpsndppgteqwakdarprhdsfyggdlkgvidrlp
yleelgvtalyftpifaspshhkydtadylaidpqfgdlptfrrlvdeahrrgikiilda
vfnhagdqffafrdvlqkgeqsrykdwffiedfpvsktsrtnyetyavqvpampklrten
pevkeylfdvarfwmeqgidgwrldvanevdhafwrefrrlvkslnpdalivgeiwhdas
gwlmgdqfdsvmnylfresvirffatgeihaerfdaeltrarmlypeqaaqglwnlldsh
dterfltscggneakfrlavlfqmtylgtpliyygdeigmagatdpdcrrpmiweekeqn
rglfefykelirlrhrlasltr

SCOPe Domain Coordinates for d1jf6a3:

Click to download the PDB-style file with coordinates for d1jf6a3.
(The format of our PDB-style files is described here.)

Timeline for d1jf6a3: