Lineage for d1jf6a1 (1jf6 A:1-120)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 223262Superfamily b.1.18: E set domains [81296] (17 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 223308Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (13 proteins)
    domains of unknown function associated with different type of catalytic domains in a different sequential location
  6. 223402Protein Maltogenic amylase, N-terminal domain N [49221] (4 species)
    precedes the catalytic (beta/alpha)8-barrel domain
  7. 223409Species Thermoactinomyces vulgaris, TVAII [TaxId:2026] [49223] (7 PDB entries)
  8. 223418Domain d1jf6a1: 1jf6 A:1-120 [71650]
    Other proteins in same PDB: d1jf6a2, d1jf6a3, d1jf6b2, d1jf6b3

Details for d1jf6a1

PDB Entry: 1jf6 (more details), 3.2 Å

PDB Description: crystal structure of thermoactinomyces vulgaris r-47 alpha-amylase mutant f286y

SCOP Domain Sequences for d1jf6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jf6a1 b.1.18.2 (A:1-120) Maltogenic amylase, N-terminal domain N {Thermoactinomyces vulgaris, TVAII}
mlleaifheakgsyaypisetqlrvrlrakkgdvvrcevlyadryaspeeelahalagka
gsderfdyfeallecstkrvkyvflltgpqgeavyfgetgfsaerskagvfqyayihrse

SCOP Domain Coordinates for d1jf6a1:

Click to download the PDB-style file with coordinates for d1jf6a1.
(The format of our PDB-style files is described here.)

Timeline for d1jf6a1: