Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins) members of the family may contain various insert subdomains in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain |
Protein Maltogenic amylase, central domain [51465] (4 species) contains an additional N-terminal domain |
Species Thermoactinomyces vulgaris, TVAII [TaxId:2026] [51467] (12 PDB entries) |
Domain d1jf5b3: 1jf5 B:121-502 [71649] Other proteins in same PDB: d1jf5a1, d1jf5a2, d1jf5b1, d1jf5b2 complexed with ca; mutant has additional subdomain(s) that are not in the common domain |
PDB Entry: 1jf5 (more details), 3.2 Å
SCOPe Domain Sequences for d1jf5b3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jf5b3 c.1.8.1 (B:121-502) Maltogenic amylase, central domain {Thermoactinomyces vulgaris, TVAII [TaxId: 2026]} vfttpewakeaviyqifperfangdpsndppgteqwakdarprhdsfyggdlkgvidrlp yleelgvtalyftpifaspshhkydtadylaidpqfgdlptfrrlvdeahrrgikiilda vfnhagdqffafrdvlqkgeqsrykdwffiedfpvsktsrtnyetaavqvpampklrten pevkeylfdvarfwmeqgidgwrldvanevdhafwrefrrlvkslnpdalivgeiwhdas gwlmgdqfdsvmnylfresvirffatgeihaerfdaeltrarmlypeqaaqglwnlldsh dterfltscggneakfrlavlfqmtylgtpliyygdeigmagatdpdcrrpmiweekeqn rglfefykelirlrhrlasltr
Timeline for d1jf5b3: