SCOP 1.69: Domain d1j8hd2: 1j8h D:118-203

Lineage for d1j8hd2 (1j8h D:118-203)

Root: SCOP 1.69
Class b: All beta proteins [48724] (144 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (4 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
Protein T-cell antigen receptor [49125] (6 species)
Species Human (Homo sapiens), alpha-chain [TaxId:9606] [49127] (9 PDB entries)
Domain d1j8hd2: 1j8h D:118-203 [71607]
Other proteins in same PDB: d1j8ha1, d1j8ha2, d1j8hb1, d1j8hb2, d1j8hd1, d1j8he1

Details for d1j8hd2

PDB Entry: 1j8h (more details), 2.4 Å

PDB Description: crystal structure of a complex of a human alpha/beta-t cell receptor, influenza ha antigen peptide, and mhc class ii molecule, hla-dr4

SCOP Domain Sequences for d1j8hd2:

Sequence, based on SEQRES records: (download)

>d1j8hd2 b.1.1.2 (D:118-203) T-cell antigen receptor {Human (Homo sapiens), alpha-chain}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdktvldmrsmdfksns
avawsnksdfacanafnnsiipedtf

Sequence, based on observed residues (ATOM records): (download)

>d1j8hd2 b.1.1.2 (D:118-203) T-cell antigen receptor {Human (Homo sapiens), alpha-chain}
iqnpdpavyqlrssdksvclftdfdsqtnvsqskdsdvyitdktvldmrsmdfksnsava
wsnksdfacanafnnsiipedtf

SCOP Domain Coordinates for d1j8hd2:

Click to download the PDB-style file with coordinates for d1j8hd2.
(The format of our PDB-style files is described here.)

Timeline for d1j8hd2: