Lineage for d1j5ta1 (1j5t A:2-230)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2435328Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 2435860Family c.1.2.4: Tryptophan biosynthesis enzymes [51381] (4 proteins)
  6. 2435861Protein Indole-3-glycerophosphate synthase, IPGS [51385] (4 species)
  7. 2435872Species Thermotoga maritima [TaxId:2336] [75052] (2 PDB entries)
    TM0140
  8. 2435875Domain d1j5ta1: 1j5t A:2-230 [71583]
    Other proteins in same PDB: d1j5ta2
    structural genomics
    complexed with cl

Details for d1j5ta1

PDB Entry: 1j5t (more details), 3 Å

PDB Description: crystal structure of indole-3-glycerol phosphate synthase (tm0140) from thermotoga maritima at 3.0 a resolution
PDB Compounds: (A:) indole-3-glycerol phosphate synthase

SCOPe Domain Sequences for d1j5ta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j5ta1 c.1.2.4 (A:2-230) Indole-3-glycerophosphate synthase, IPGS {Thermotoga maritima [TaxId: 2336]}
ivqrrnhrflevlsgkervkiiaefkkaspsagdinadasledfirmydeladaisilte
khyfkgdpafvraarnltcrpilakdfyidtvqvklassvgadailiiariltaeqikei
yeaaeelgmdslvevhsredlekvfsvirpkiigintrdldtfeikknvlwellplvpdd
tvvvaesgikdprelkdlrgkvnavlvgtsimkaenprrfleemrawse

SCOPe Domain Coordinates for d1j5ta1:

Click to download the PDB-style file with coordinates for d1j5ta1.
(The format of our PDB-style files is described here.)

Timeline for d1j5ta1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1j5ta2