Lineage for d1ivxb3 (1ivx B:97-211)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1640316Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 1640510Superfamily d.17.2: Amine oxidase N-terminal region [54416] (1 family) (S)
  5. 1640511Family d.17.2.1: Amine oxidase N-terminal region [54417] (2 proteins)
    duplication: contains two domains of this fold
  6. 1640512Protein Copper amine oxidase, domains 1 and 2 [54418] (4 species)
  7. 1640513Species Arthrobacter globiformis [TaxId:1665] [54421] (40 PDB entries)
    Uniprot P46881 9-628
  8. 1640639Domain d1ivxb3: 1ivx B:97-211 [71467]
    Other proteins in same PDB: d1ivxa1, d1ivxb1
    complexed with cu

Details for d1ivxb3

PDB Entry: 1ivx (more details), 2.2 Å

PDB Description: crystal structure of copper amine oxidase from arthrobacter globiformis: holo form generated by biogenesis in crystal.
PDB Compounds: (B:) amine oxidase

SCOPe Domain Sequences for d1ivxb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ivxb3 d.17.2.1 (B:97-211) Copper amine oxidase, domains 1 and 2 {Arthrobacter globiformis [TaxId: 1665]}
elpvleeefevveqllatderwlkalaarnldvskvrvaplsagvfeyaeergrrilrgl
afvqdfpedsawahpvdglvayvdvvskevtrvidtgvfpvpaehgnytdpeltg

SCOPe Domain Coordinates for d1ivxb3:

Click to download the PDB-style file with coordinates for d1ivxb3.
(The format of our PDB-style files is described here.)

Timeline for d1ivxb3: