SCOPe 2.03: Domain d1it6b_: 1it6 B:

Lineage for d1it6b_ (1it6 B:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
   4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication

4. Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families)
   different families of this superfamily are groupped in a single Pfam family, Pfam PF00149

5. Family d.159.1.3: Protein serine/threonine phosphatase [56310] (6 proteins)

6. Protein Protein phosphatase-1 (PP-1) [56311] (5 species)

7. Species Human (Homo sapiens), beta isoform [TaxId:9606] [64430] (5 PDB entries)
   Uniprot P36873

8. Domain d1it6b_: 1it6 B: [71408]
   complexed with cyu, mn

Details for d1it6b_

PDB Entry: 1it6, 2 Å

PDB Description: crystal structure of the complex between calyculin a and the catalytic subunit of protein phosphatase 1

PDB Compounds: (B:) serine/threonine protein phosphatase 1 gamma (pp1-gamma) catalytic subunit

SCOPe Domain Sequences for d1it6b_:

Sequence; same for both SEQRES and ATOM records:

>d1it6b_ d.159.1.3 (B:) Protein phosphatase-1 (PP-1) {Human (Homo sapiens), beta isoform [TaxId: 9606]}
lnidsiiqrllevrgskpgknvqlqeneirglclksreiflsqpilleleaplkicgdih
gqyydllrlfeyggfppesnylflgdyvdrgkqsleticlllaykikypenffllrgnhe
casinriygfydeckrryniklwktftdcfnclpiaaivdekifcchgglspdlqsmeqi
rrimrptdvpdqgllcdllwsdpdkdvlgwgendrgvsftfgaevvakflhkhdldlicr
ahqvvedgyeffakrqlvtlfsapnycgefdnagammsvdetlmcsfqilkpa

Timeline for d1it6b_:

• d1it6b_ first appeared in SCOP 1.61
  
• d1it6b_ appears in SCOPe 2.02
  
• d1it6b_ appears in SCOPe 2.04
  
• d1it6b_ appears in the current release, SCOPe 2.08