Class a: All alpha proteins [46456] (289 folds) |
Fold a.11: Acyl-CoA binding protein-like [47026] (2 superfamilies) core: 3 helices; bundle, closed, left-handed twist; up-and-down |
Superfamily a.11.2: Second domain of FERM [47031] (2 families) automatically mapped to Pfam PF00373 |
Family a.11.2.1: Second domain of FERM [47032] (9 proteins) |
Protein Merlin [68980] (2 species) the neurofibromatosis 2 tumor suppressor protein |
Species Mouse (Mus musculus) [TaxId:10090] [74702] (1 PDB entry) |
Domain d1isna1: 1isn A:104-214 [71400] Other proteins in same PDB: d1isna2, d1isna3 |
PDB Entry: 1isn (more details), 2.9 Å
SCOPe Domain Sequences for d1isna1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1isna1 a.11.2.1 (A:104-214) Merlin {Mouse (Mus musculus) [TaxId: 10090]} naeeelvqeitqhlfflqvkkqildekvycppeasvllasyavqakygdydpsvhkrgfl aqeellpkrvinlyqmtpemweeritawyaehrgrardeaemeylkiaqdl
Timeline for d1isna1: