Lineage for d1ihxd1 (1ihx D:1-148,D:313-334)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 387036Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 387037Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (11 families) (S)
  5. 387801Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (14 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 387918Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (16 species)
  7. 388019Species Lobster (Palinurus versicolor) [51811] (5 PDB entries)
  8. 388029Domain d1ihxd1: 1ihx D:1-148,D:313-334 [71217]
    Other proteins in same PDB: d1ihxa2, d1ihxb2, d1ihxc2, d1ihxd2
    complexed with snd, so4

Details for d1ihxd1

PDB Entry: 1ihx (more details), 2.8 Å

PDB Description: Crystal structure of two D-glyceraldehyde-3-phosphate dehydrogenase complexes: a case of asymmetry

SCOP Domain Sequences for d1ihxd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ihxd1 c.2.1.3 (D:1-148,D:313-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Lobster (Palinurus versicolor)}
skigingfgrigrlvlrtalemgaqvvavndpfialeymvymfkydsthgmfkgevkved
galvvdgkkitvfnemkpenipwskagaeyivestgvfttiekasahfkggakkviisap
sadapmfvcgvnlekyskdmkvvsnasXnefgysqrvidlikhmqkvdsa

SCOP Domain Coordinates for d1ihxd1:

Click to download the PDB-style file with coordinates for d1ihxd1.
(The format of our PDB-style files is described here.)

Timeline for d1ihxd1: