Lineage for d1igoa_ (1igo A:)
- Root: SCOP 1.61
Class b: All beta proteins [48724] (111 folds) 
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (14 families) 
Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (2 proteins) Protein Xylanase II [49979] (13 species) 
Species Bacillus subtilis, B230 [TaxId:1423] [74910] (1 PDB entry) 
Domain d1igoa_: 1igo A: [71209]
Details for d1igoa_
PDB Entry: 1igo (more details), 2.2 Å
PDB Description: Family 11 xylanase
SCOP Domain Sequences for d1igoa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1igoa_ b.29.1.11 (A:) Xylanase II {Bacillus subtilis, B230}
attitsnqtgthdgydyelwkdsgntsmtlnsggafsaqwsnignalfrkgkkfdstkth
sqlgnisinynatfnpggnsylcvygwtkdplteyyivdnwgtyrptgtpkgtftvdggt
ydiyettrinqpsiigiatfkqywsvrqtkrtsgtvsvsehfkkweslgmpmgkmyetal
tvegyqsngsanvtanvltiggkpl
SCOP Domain Coordinates for d1igoa_:
Click to download the PDB-style file with coordinates for d1igoa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1igoa_:
- d1igoa_ is new in SCOP 1.61
- d1igoa_ appears in SCOP 1.63
- d1igoa_ appears in the current release, SCOPe 2.08
View in 3D
