Class d: Alpha and beta proteins (a+b) [53931] (212 folds) |
Fold d.129: TBP-like [55944] (4 superfamilies) |
Superfamily d.129.3: Bet v1-like [55961] (4 families) |
Family d.129.3.1: Pathogenesis-related protein 10 (PR10)-like [55962] (2 proteins) |
Protein Plant pathogenesis-related protein PR10 [75543] (1 species) |
Species Yellow lupine (Lupinus luteus) [TaxId:3873] [75544] (2 PDB entries) |
Domain d1icxa_: 1icx A: [71191] |
PDB Entry: 1icx (more details), 1.95 Å
SCOP Domain Sequences for d1icxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1icxa_ d.129.3.1 (A:) Plant pathogenesis-related protein PR10 {Yellow lupine (Lupinus luteus)} gifafeneqsstvapaklykaltkdsdeivpkviepiqsveivegnggpgtikkiiaihd ghtsfvlhkldaideanltynysiiggegldeslekisyeskilpgpdggsigkinvkfh tkgdvlsetvrdqakfkglglfkaiegyvlahpdy
Timeline for d1icxa_: