Lineage for d1icxa_ (1icx A:)
- Root: SCOP 1.61
Class d: Alpha and beta proteins (a+b) [53931] (212 folds) 
Fold d.129: TBP-like [55944] (4 superfamilies) 
Superfamily d.129.3: Bet v1-like [55961] (4 families) 
Family d.129.3.1: Pathogenesis-related protein 10 (PR10)-like [55962] (2 proteins) Protein Plant pathogenesis-related protein PR10 [75543] (1 species) Species Yellow lupine (Lupinus luteus) [TaxId:3873] [75544] (2 PDB entries) 
Domain d1icxa_: 1icx A: [71191]
Details for d1icxa_
PDB Entry: 1icx (more details), 1.95 Å
PDB Description: crystal structure of pathogenesis-related protein llpr10.1a from yellow lupine
SCOP Domain Sequences for d1icxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1icxa_ d.129.3.1 (A:) Plant pathogenesis-related protein PR10 {Yellow lupine (Lupinus luteus)}
gifafeneqsstvapaklykaltkdsdeivpkviepiqsveivegnggpgtikkiiaihd
ghtsfvlhkldaideanltynysiiggegldeslekisyeskilpgpdggsigkinvkfh
tkgdvlsetvrdqakfkglglfkaiegyvlahpdy
SCOP Domain Coordinates for d1icxa_:
Click to download the PDB-style file with coordinates for d1icxa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1icxa_:
- d1icxa_ is new in SCOP 1.61
- d1icxa_ appears in SCOP 1.63
- d1icxa_ appears in the current release, SCOPe 2.08
View in 3D