Lineage for d1hy3b_ (1hy3 B:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1593542Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1593543Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1594194Family c.37.1.5: PAPS sulfotransferase [52575] (15 proteins)
    Pfam PF00685
    similar to the nucleotide/nucleoside kinases but transfer sulphate group
  6. 1594208Protein Estrogen sulfotransferase (STE, sult1e1) [52576] (2 species)
  7. 1594209Species Human (Homo sapiens) [TaxId:9606] [75198] (5 PDB entries)
  8. 1594213Domain d1hy3b_: 1hy3 B: [71091]
    complexed with pps; mutant

Details for d1hy3b_

PDB Entry: 1hy3 (more details), 1.8 Å

PDB Description: crystal structure of human estrogen sulfotransferase v269e mutant in the presence of paps
PDB Compounds: (B:) estrogen sulfotransferase

SCOPe Domain Sequences for d1hy3b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hy3b_ c.37.1.5 (B:) Estrogen sulfotransferase (STE, sult1e1) {Human (Homo sapiens) [TaxId: 9606]}
seldyyekfeevhgilmykdfvkywdnveafqarpddlviatypksgttwvseivymiyk
egdvekckedvifnripflecrkenlmngvkqldemnsprivkthlppellpasfwekdc
kiiylcrnakdvavsfyyfflmvaghpnpgsfpefvekfmqgqvpygswykhvkswwekg
ksprvlflfyedlkedirkeviklihflerkpseelvdriihhtsfqemknnpstnyttl
pdeimnqklspfmrkgitgdwknhftealnekfdkhyeqqmkestlkf

SCOPe Domain Coordinates for d1hy3b_:

Click to download the PDB-style file with coordinates for d1hy3b_.
(The format of our PDB-style files is described here.)

Timeline for d1hy3b_: