Lineage for d1gxdc_ (1gxd C:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 798661Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 799373Superfamily b.40.3: TIMP-like [50242] (3 families) (S)
  5. 799374Family b.40.3.1: Tissue inhibitor of metalloproteinases, TIMP [50243] (2 proteins)
    contains an irregular alpha+beta subdomain in the C-terminal extension
  6. 799384Protein TIMP-2 [50246] (2 species)
  7. 799389Species Human (Homo sapiens) [TaxId:9606] [50247] (3 PDB entries)
  8. 799391Domain d1gxdc_: 1gxd C: [70703]
    Other proteins in same PDB: d1gxda1, d1gxda2, d1gxda3, d1gxda4, d1gxda5, d1gxda6, d1gxdb1, d1gxdb2, d1gxdb3, d1gxdb4, d1gxdb5, d1gxdb6
    complexed with proMMP-2

Details for d1gxdc_

PDB Entry: 1gxd (more details), 3.1 Å

PDB Description: prommp-2/timp-2 complex
PDB Compounds: (C:) metalloproteinase inhibitor 2

SCOP Domain Sequences for d1gxdc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gxdc_ b.40.3.1 (C:) TIMP-2 {Human (Homo sapiens) [TaxId: 9606]}
cscspvhpqqafcnadvvirakavsekevdsgndiygnpikriqyeikqikmfkgpekdi
efiytapssavcgvsldvggkkeyliagkaegdgkmhitlcdfivpwdtlsttqkkslnh
ryqmgceckitrcpmipcyisspdeclwmdwvtekninghqakffacikrsdgscawyrg
aappkqefldie

SCOP Domain Coordinates for d1gxdc_:

Click to download the PDB-style file with coordinates for d1gxdc_.
(The format of our PDB-style files is described here.)

Timeline for d1gxdc_: