Class b: All beta proteins [48724] (174 folds) |
Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.3: TIMP-like [50242] (3 families) |
Family b.40.3.1: Tissue inhibitor of metalloproteinases, TIMP [50243] (2 proteins) contains an irregular alpha+beta subdomain in the C-terminal extension |
Protein TIMP-2 [50246] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [50247] (3 PDB entries) |
Domain d1gxdc_: 1gxd C: [70703] Other proteins in same PDB: d1gxda1, d1gxda2, d1gxda3, d1gxda4, d1gxda5, d1gxda6, d1gxdb1, d1gxdb2, d1gxdb3, d1gxdb4, d1gxdb5, d1gxdb6 complexed with proMMP-2 |
PDB Entry: 1gxd (more details), 3.1 Å
SCOP Domain Sequences for d1gxdc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gxdc_ b.40.3.1 (C:) TIMP-2 {Human (Homo sapiens) [TaxId: 9606]} cscspvhpqqafcnadvvirakavsekevdsgndiygnpikriqyeikqikmfkgpekdi efiytapssavcgvsldvggkkeyliagkaegdgkmhitlcdfivpwdtlsttqkkslnh ryqmgceckitrcpmipcyisspdeclwmdwvtekninghqakffacikrsdgscawyrg aappkqefldie
Timeline for d1gxdc_: