Lineage for d1gxdb5 (1gxd B:249-308)
- Root: SCOP 1.61
Class g: Small proteins [56992] (59 folds) 
Fold g.14: Kringle-like [57439] (1 superfamily) Superfamily g.14.1: Kringle-like [57440] (2 families) 
Family g.14.1.2: Fibronectin type II module [57459] (4 proteins) 
Protein Gelatinase A (MMP-2) type II modules [57464] (1 species) Species Human (Homo sapiens) [TaxId:9606] [57465] (6 PDB entries) 
Domain d1gxdb5: 1gxd B:249-308 [70701]
Other proteins in same PDB: d1gxda1, d1gxda2, d1gxda3, d1gxdb1, d1gxdb2, d1gxdb3, d1gxdc_, d1gxdd_
Details for d1gxdb5
PDB Entry: 1gxd (more details), 3.1 Å
PDB Description: prommp-2/timp-2 complex
SCOP Domain Sequences for d1gxdb5:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gxdb5 g.14.1.2 (B:249-308) Gelatinase A (MMP-2) type II modules {Human (Homo sapiens)}
alftmggnaegqpckfpfrfqgtsydscttegrtdgyrwcgttedydrdkkygfcpetam
SCOP Domain Coordinates for d1gxdb5:
Click to download the PDB-style file with coordinates for d1gxdb5.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1gxdb5:
- d1gxdb5 is new in SCOP 1.61
- d1gxdb5 appears in SCOP 1.63
- d1gxdb5 appears in the current release, SCOPe 2.08
View in 3D
