Class b: All beta proteins [48724] (165 folds) |
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (7 families) contains copper-binding site |
Family b.6.1.3: Multidomain cupredoxins [49550] (7 proteins) |
Protein Laccase [49557] (5 species) consists of three domains of this fold |
Species Melanocarpus albomyces [TaxId:204285] [74873] (3 PDB entries) |
Domain d1gw0b2: 1gw0 B:163-343 [70627] |
PDB Entry: 1gw0 (more details), 2.4 Å
SCOP Domain Sequences for d1gw0b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gw0b2 b.6.1.3 (B:163-343) Laccase {Melanocarpus albomyces [TaxId: 204285]} ydidlgvfpitdyyyraaddlvhftqnnappfsdnvlingtavnpntgegqyanvtltpg krhrlrilntstenhfqvslvnhtmtviaadmvpvnamtvdslflavgqrydvvidasra pdnywfnvtfggqaacggslnphpaaifhyagapgglptdegtppvdhqcldtldvrpvv p
Timeline for d1gw0b2: