SCOPe 2.08: Domain d1gw0b2: 1gw0 B:163-343

Lineage for d1gw0b2 (1gw0 B:163-343)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.3: Multidomain cupredoxins [49550] (15 proteins)

6. Protein Laccase, middle domain [418906] (5 species)

7. Species Fungus (Melanocarpus albomyces) [TaxId:204285] [419308] (9 PDB entries)

8. Domain d1gw0b2: 1gw0 B:163-343 [70627]
   Other proteins in same PDB: d1gw0a1, d1gw0a3, d1gw0b1, d1gw0b3
   complexed with cl, cu, nag, oxy, so4

Details for d1gw0b2

PDB Entry: 1gw0, 2.4 Å

PDB Description: crystal structure of laccase from melanocarpus albomyces in four copper form

PDB Compounds: (B:) Laccase-1

SCOPe Domain Sequences for d1gw0b2:

Sequence; same for both SEQRES and ATOM records:

>d1gw0b2 b.6.1.3 (B:163-343) Laccase, middle domain {Fungus (Melanocarpus albomyces) [TaxId: 204285]}
ydidlgvfpitdyyyraaddlvhftqnnappfsdnvlingtavnpntgegqyanvtltpg
krhrlrilntstenhfqvslvnhtmtviaadmvpvnamtvdslflavgqrydvvidasra
pdnywfnvtfggqaacggslnphpaaifhyagapgglptdegtppvdhqcldtldvrpvv
p

Timeline for d1gw0b2:

• d1gw0b2 first appeared in SCOP 1.61
  
• d1gw0b2 appears in SCOPe 2.07