Class b: All beta proteins [48724] (180 folds) |
Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) this domain is C-terminal to the catalytic beta/alpha barrel domain |
Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins) this domain follows the catalytic beta/alpha barrel domain |
Protein Maltogenic amylase [51031] (4 species) |
Species Thermus sp. [TaxId:275] [51032] (2 PDB entries) |
Domain d1gvib2: 1gvi B:506-588 [70608] Other proteins in same PDB: d1gvia1, d1gvia3, d1gvib1, d1gvib3 |
PDB Entry: 1gvi (more details), 3.3 Å
SCOPe Domain Sequences for d1gvib2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gvib2 b.71.1.1 (B:506-588) Maltogenic amylase {Thermus sp. [TaxId: 275]} gdvafltaddevnhlvyaktdgnetvmiiinrsneaaeipmpidargkwlvnlltgerfa aeaetlcvslppygfvlyavesw
Timeline for d1gvib2: