SCOP 1.65: Domain d1guea_: 1gue A:

Lineage for d1guea_ (1gue A:)

1. Root: SCOP 1.65

2. Class f: Membrane and cell surface proteins and peptides [56835] (36 folds)

3. Fold f.13: Family A G protein-coupled receptor-like [81322] (1 superfamily)
   core: up-and-down bundle of seven transmembrane helices tilted 20 degrees with respect to the plane of the membrane

4. Superfamily f.13.1: Family A G protein-coupled receptor-like [81321] (2 families)

5. Family f.13.1.1: Bacteriorhodopsin-like [81319] (4 proteins)

6. Protein Sensory rhodopsin II [64526] (1 species)

7. Species Archaeon Natronobacterium pharaonis [TaxId:2257] [64527] (5 PDB entries)

8. Domain d1guea_: 1gue A: [70581]
   complexed with cl, ret

Details for d1guea_

PDB Entry: 1gue, 2.27 Å

PDB Description: sensory rhodopsin ii

SCOP Domain Sequences for d1guea_:

Sequence; same for both SEQRES and ATOM records:

>d1guea_ f.13.1.1 (A:) Sensory rhodopsin II {Archaeon Natronobacterium pharaonis}
vglttlfwlgaigmlvgtlafawagrdagsgerryyvtlvgisgiaavayvvmalgvgwv
pvaertvfapryidwilttplivyflgllagldsrefgivitlntvvmlagfagamvpgi
eryalfgmgavaflglvyylvgpmtesasqrssgikslyvrlrnltvilwaiypfiwllg
ppgvalltptvdvalivyldlvtkvgfgfialdaaatl

Timeline for d1guea_:

• d1guea_ first appeared in SCOP 1.61
  
• d1guea_ appears in SCOP 1.63
  
• d1guea_ appears in SCOP 1.67
  
• d1guea_ appears in the current release, SCOPe 2.08