Lineage for d1gtha2 (1gth A:533-844)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1565956Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1567263Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 1567264Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 proteins)
  6. 1567472Protein Dihydropyrimidine dehydrogenase, domain 4 [51410] (1 species)
  7. 1567473Species Pig (Sus scrofa) [TaxId:9823] [51411] (5 PDB entries)
  8. 1567486Domain d1gtha2: 1gth A:533-844 [70484]
    Other proteins in same PDB: d1gtha1, d1gtha3, d1gtha4, d1gtha5, d1gthb1, d1gthb3, d1gthb4, d1gthb5, d1gthc1, d1gthc3, d1gthc4, d1gthc5, d1gthd1, d1gthd3, d1gthd4, d1gthd5
    complexed with fad, fmn, idh, iur, ndp, sf4, ura

Details for d1gtha2

PDB Entry: 1gth (more details), 2.25 Å

PDB Description: dihydropyrimidine dehydrogenase (dpd) from pig, ternary complex with nadph and 5-iodouracil
PDB Compounds: (A:) dihydropyrimidine dehydrogenase

SCOPe Domain Sequences for d1gtha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gtha2 c.1.4.1 (A:533-844) Dihydropyrimidine dehydrogenase, domain 4 {Pig (Sus scrofa) [TaxId: 9823]}
isvemaglkfinpfglasaapttsssmirrafeagwgfaltktfsldkdivtnvsprivr
gttsgpmygpgqssflnielisektaaywcqsvtelkadfpdniviasimcsynkndwme
lsrkaeasgadalelnlscphgmgergmglacgqdpelvrnicrwvrqavqipffakltp
nvtdivsiaraakeggadgvtatntvsglmglkadgtpwpavgagkrttyggvsgtairp
ialravttiaralpgfpilatggidsaesglqflhsgasvlqvcsavqnqdftviqdyct
glkallylksie

SCOPe Domain Coordinates for d1gtha2:

Click to download the PDB-style file with coordinates for d1gtha2.
(The format of our PDB-style files is described here.)

Timeline for d1gtha2: