SCOP 1.63: Domain d1grwb_: 1grw B:

Lineage for d1grwb_ (1grw B:)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.11: PapD-like [49354] (2 families)
   contains PP switch between strands D and C'

5. Family b.1.11.2: Major sperm protein [49360] (1 protein)

6. Protein Major sperm protein [49361] (2 species)

7. Species C.elegans (Caenorhabditis elegans) [74862] (1 PDB entry)

8. Domain d1grwb_: 1grw B: [70392]

Details for d1grwb_

PDB Entry: 1grw, 2.6 Å

PDB Description: c. elegans major sperm protein

SCOP Domain Sequences for d1grwb_:

Sequence; same for both SEQRES and ATOM records:

>d1grwb_ b.1.11.2 (B:) Major sperm protein {C.elegans (Caenorhabditis elegans)}
svppgdiqtqpgtkivfnapyddkhtyhikvinssarrigygikttnmkrlgvdppcgvl
dpkeavllavscdafafgqedtnndritvewtntpdgaakqfrrewfqgdgmvrrknlpi
eynp

Timeline for d1grwb_:

• d1grwb_ first appeared in SCOP 1.61
  
• d1grwb_ appears in SCOP 1.65
  
• d1grwb_ appears in the current release, SCOPe 2.08