![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
![]() | Superfamily b.18.1: Galactose-binding domain-like [49785] (33 families) ![]() |
![]() | Family b.18.1.9: APC10-like [69210] (2 proteins) Pfam PF03256 |
![]() | Protein APC10/DOC1 subunit of the anaphase-promoting complex [69211] (2 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [74892] (1 PDB entry) |
![]() | Domain d1gqpb_: 1gqp B: [70373] complexed with br |
PDB Entry: 1gqp (more details), 2.2 Å
SCOPe Domain Sequences for d1gqpb_:
Sequence, based on SEQRES records: (download)
>d1gqpb_ b.18.1.9 (B:) APC10/DOC1 subunit of the anaphase-promoting complex {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} svlvlddrivdaatkdlyvngfqeeiqyqnptpenlqhmfhqgieildsarminvthlal wkpssfklgnpvdfalddnydtfwqsdggqphqldimfskrmdicvmaiffsmiadesya pslvkvyaghspsdarfykmlevrnvngwvalrfldnreddqllkcqfirllfpvnheng kdthlrgirlyvps
>d1gqpb_ b.18.1.9 (B:) APC10/DOC1 subunit of the anaphase-promoting complex {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} svlvlddrtkdlyvngfqeiqyqnptpenlqhmfhqgieildsarminvthlalwkpssf klgnpvdfalddnydtfwqsdggqphqldimfskrmdicvmaiffsmiadesyapslvkv yaghspsdarfykmlevrnvngwvalrfldnreddqllkcqfirllfpvnhengkdthlr girlyvps
Timeline for d1gqpb_: