Lineage for d1gkpa1 (1gkp A:2-54,A:390-459)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 304009Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily)
    pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns
  4. 304010Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (7 families) (S)
    this domain is interrupted by the catalytic beta/alpha barrel domain
  5. 304054Family b.92.1.3: Hydantoinase (dihydropyrimidinase) [75044] (2 proteins)
  6. 304055Protein D-hydantoinase [75045] (3 species)
  7. 304070Species Thermus sp. [TaxId:275] [75046] (2 PDB entries)
  8. 304071Domain d1gkpa1: 1gkp A:2-54,A:390-459 [70231]
    Other proteins in same PDB: d1gkpa2, d1gkpb2, d1gkpc2, d1gkpd2, d1gkpe2, d1gkpf2

Details for d1gkpa1

PDB Entry: 1gkp (more details), 1.29 Å

PDB Description: d-hydantoinase (dihydropyrimidinase) from thermus sp. in space group c2221

SCOP Domain Sequences for d1gkpa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gkpa1 b.92.1.3 (A:2-54,A:390-459) D-hydantoinase {Thermus sp.}
pllikngeiitadsrykadiyaegetitrigqnleappgtevidatgkyvfpgXadlvvy
dpqyrgtisvktqhvnndyngfegfeidgrpsvvtvrgkvavrdgqfvgekgwgkllrre
pmyf

SCOP Domain Coordinates for d1gkpa1:

Click to download the PDB-style file with coordinates for d1gkpa1.
(The format of our PDB-style files is described here.)

Timeline for d1gkpa1: