Lineage for d1gjia2 (1gji A:7-181)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 659309Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 659552Superfamily b.2.5: p53-like transcription factors [49417] (7 families) (S)
  5. 659607Family b.2.5.3: Rel/Dorsal transcription factors, DNA-binding domain [81315] (6 proteins)
  6. 659630Protein p65 subunit of NF-kappa B (NFKB), N-terminal domain [49428] (3 species)
  7. 659631Species Chicken (Gallus gallus), C-rel [TaxId:9031] [74867] (1 PDB entry)
  8. 659632Domain d1gjia2: 1gji A:7-181 [70188]
    Other proteins in same PDB: d1gjia1, d1gjib1

Details for d1gjia2

PDB Entry: 1gji (more details), 2.85 Å

PDB Description: Crystal structure of c-Rel bound to DNA
PDB Compounds: (A:) c-rel proto-oncogene protein

SCOP Domain Sequences for d1gjia2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gjia2 b.2.5.3 (A:7-181) p65 subunit of NF-kappa B (NFKB), N-terminal domain {Chicken (Gallus gallus), C-rel [TaxId: 9031]}
pyieifeqprqrgmrfrykcegrsagsipgehstdnnktfpsiqilnyfgkvkirttlvt
knepykphphdlvgkdcrdgyyeaefgperrvlsfqnlgiqcvkkkdlkesislriskki
npfnvpeeqlhnideydlnvvrlcfqaflpdehgnytlalpplisnpiydnrapn

SCOP Domain Coordinates for d1gjia2:

Click to download the PDB-style file with coordinates for d1gjia2.
(The format of our PDB-style files is described here.)

Timeline for d1gjia2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gjia1