PDB entry 1gji

View 1gji on RCSB PDB site
Description: Crystal structure of c-Rel bound to DNA
Class: transcription/DNA
Keywords: NF-kB/DNA COMPLEX, TRANSCRIPTION FACTOR, c-Rel HOMODIMER
Deposited on 2001-05-30, released 2002-05-30
The last revision prior to the SCOP 1.73 freeze date was dated 2002-05-30, with a file datestamp of 2007-07-20.
Experiment type: XRAY
Resolution: 2.85 Å
R-factor: 0.227
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: c-rel proto-oncogene protein
    Species: GALLUS GALLUS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1gjia1, d1gjia2
  • Chain 'B':
    Compound: c-rel proto-oncogene protein
    Species: GALLUS GALLUS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1gjib1, d1gjib2
  • Chain 'C':
    Compound: il-2 cd28re DNA
  • Chain 'D':
    Compound: il-2 cd28re DNA

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gjiA (A:)
    pyieifeqprqrgmrfrykcegrsagsipgehstdnnktfpsiqilnyfgkvkirttlvt
    knepykphphdlvgkdcrdgyyeaefgperrvlsfqnlgiqcvkkkdlkesislriskki
    npfnvpeeqlhnideydlnvvrlcfqaflpdehgnytlalpplisnpiydnrapntaelr
    icrvnkncgsvkggdeifilcdkvqkddievrfvldnweakgsfsqadvhrqvaivfrtp
    pflrditepitvkmqlrrpsdqevsepmdfrylpd
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gjiB (B:)
    pyieifeqprqrgmrfrykcegrsagsipgehstdnnktfpsiqilnyfgkvkirttlvt
    knepykphphdlvgkdcrdgyyeaefgperrvlsfqnlgiqcvkkkdlkesislriskki
    npfnvpeeqlhnideydlnvvrlcfqaflpdehgnytlalpplisnpiydnrapntaelr
    icrvnkncgsvkggdeifilcdkvqkddievrfvldnweakgsfsqadvhrqvaivfrtp
    pflrditepitvkmqlrrpsdqevsepmdfrylpd
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.