SCOP 1.63: Domain d1gj9.1: 1gj9 A:,B:

Lineage for d1gj9.1 (1gj9 A:,B:)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (40 proteins)

6. Protein Urokinase-type plasminogen activator (LMW U-PA), catalytic domain [50586] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50587] (19 PDB entries)

8. Domain d1gj9.1: 1gj9 A:,B: [70182]
   complexed with 134, cit; mutant

Details for d1gj9.1

PDB Entry: 1gj9, 1.8 Å

PDB Description: engineering inhibitors highly selective for the s1 sites of ser190 trypsin-like serine protease drug targets

SCOP Domain Sequences for d1gj9.1:

Sequence; same for both SEQRES and ATOM records:

>g1gj9.1 b.47.1.2 (A:,B:) Urokinase-type plasminogen activator (LMW U-PA), catalytic domain {Human (Homo sapiens)}
lkfqcgqktlXiiggefttienqpwfaaiyrrhrggsvtyvcggslmspcwvisathcfi
dypkkedyivylgrsrlnsntqgemkfevenlilhkdysadtlahhndiallkirskegr
caqpsrtiqticlpsmyndpqfgtsceitgfgkeastdylypeqlkmtvvklishrecqq
phyygsevttkmlcaadpqwktdscqgdsggplvcslqgrmtltgivswgrgcalkdkpg
vytrvshflpwirshtk

Timeline for d1gj9.1:

• d1gj9.1 first appeared in SCOP 1.61
  
• d1gj9.1 appears in SCOP 1.65
  
• d1gj9.1 appears in the current release, SCOPe 2.08