SCOP 1.61: Domain d1fv0b_: 1fv0 B:

Lineage for d1fv0b_ (1fv0 B:)

1. Root: SCOP 1.61

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)

4. Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families)

5. Family a.133.1.2: Vertebrate phospholipase A2 [48623] (2 proteins)

6. Protein Snake phospholipase A2 [48624] (18 species)

7. Species Snake (Daboia russelli pulchella) [48630] (4 PDB entries)

8. Domain d1fv0b_: 1fv0 B: [70148]

Details for d1fv0b_

PDB Entry: 1fv0, 1.7 Å

PDB Description: first structural evidence of the inhibition of phospholipase a2 by aristolochic acid: crystal structure of a complex formed between phospholipase a2 and aristolochic acid

SCOP Domain Sequences for d1fv0b_:

Sequence; same for both SEQRES and ATOM records:

>d1fv0b_ a.133.1.2 (B:) Snake phospholipase A2 {Snake (Daboia russelli pulchella)}
sllefgkmileetgklaipsyssygcycgwggkgtpkdatdrccfvhdccygnlpdcnpk
sdrykykrvngaivcekgtscenricecdkaaaicfrqnlntyskkymlypdflckgelk
c

Timeline for d1fv0b_:

• d1fv0b_ is new in SCOP 1.61
  
• d1fv0b_ appears in SCOP 1.63
  
• d1fv0b_ appears in the current release, SCOPe 2.08