![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) ![]() |
![]() | Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins) members of the family may contain various insert subdomains in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain |
![]() | Protein Maltogenic amylase, central domain [51465] (4 species) contains an additional N-terminal domain |
![]() | Species Bacillus sp., cyclomaltodextrinase [TaxId:1409] [75060] (1 PDB entry) |
![]() | Domain d1ea9d3: 1ea9 D:122-503 [70092] Other proteins in same PDB: d1ea9c1, d1ea9c2, d1ea9d1, d1ea9d2 has additional subdomain(s) that are not in the common domain |
PDB Entry: 1ea9 (more details), 3.2 Å
SCOPe Domain Sequences for d1ea9d3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ea9d3 c.1.8.1 (D:122-503) Maltogenic amylase, central domain {Bacillus sp., cyclomaltodextrinase [TaxId: 1409]} fqppawvkdaifyqifperfangdtrndpegtlpwgsadptpscffggdlqgvidhldhl sklgvnavyftplfkattnhkydtedyfqidpqfgdkdtlkklvdlchergirvlldavf nhsgrtfppfvdvlkngekskykdwfhirslplevvdgiptydtfafeplmpklntehpd vkeyllkaaeywiretgidgwrldvanevshqfwrefrrvvkqanpdayilgevwhessi wlegdqfdavmnypftnavldffihqiadaekfsfmlgkqlagyprqasevmfnlldshd tarlltqadgdkrkmklavlfqftyfgtpciyygdevgldgghdpgcrkcmewdetkhdk dlfafyqtvirlrqahaalrtg
Timeline for d1ea9d3: