Lineage for d1ea9d2 (1ea9 D:504-583)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2810331Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 2810332Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 2810333Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
    this domain follows the catalytic beta/alpha barrel domain
  6. 2810619Protein Maltogenic amylase [51031] (4 species)
  7. 2810620Species Bacillus sp., cyclomaltodextrinase [TaxId:1409] [75016] (1 PDB entry)
  8. 2810622Domain d1ea9d2: 1ea9 D:504-583 [70091]
    Other proteins in same PDB: d1ea9c1, d1ea9c3, d1ea9d1, d1ea9d3

Details for d1ea9d2

PDB Entry: 1ea9 (more details), 3.2 Å

PDB Description: cyclomaltodextrinase
PDB Compounds: (D:) cyclomaltodextrinase

SCOPe Domain Sequences for d1ea9d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ea9d2 b.71.1.1 (D:504-583) Maltogenic amylase {Bacillus sp., cyclomaltodextrinase [TaxId: 1409]}
tfkfltaeknsrqiaylreddqdtilvvmnndkaghtltlpvrhaqwthlwqddvltaah
gqltvklpaygfavlkassd

SCOPe Domain Coordinates for d1ea9d2:

Click to download the PDB-style file with coordinates for d1ea9d2.
(The format of our PDB-style files is described here.)

Timeline for d1ea9d2: