SCOPe 2.08: Domain d1ea9c3: 1ea9 C:122-503

Lineage for d1ea9c3 (1ea9 C:122-503)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
   members of the family may contain various insert subdomains
   in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain

6. Protein Maltogenic amylase, central domain [51465] (4 species)
   contains an additional N-terminal domain

7. Species Bacillus sp., cyclomaltodextrinase [TaxId:1409] [75060] (1 PDB entry)

8. Domain d1ea9c3: 1ea9 C:122-503 [70089]
   Other proteins in same PDB: d1ea9c1, d1ea9c2, d1ea9d1, d1ea9d2
   has additional subdomain(s) that are not in the common domain

Details for d1ea9c3

PDB Entry: 1ea9, 3.2 Å

PDB Description: cyclomaltodextrinase

PDB Compounds: (C:) cyclomaltodextrinase

SCOPe Domain Sequences for d1ea9c3:

Sequence; same for both SEQRES and ATOM records:

>d1ea9c3 c.1.8.1 (C:122-503) Maltogenic amylase, central domain {Bacillus sp., cyclomaltodextrinase [TaxId: 1409]}
fqppawvkdaifyqifperfangdtrndpegtlpwgsadptpscffggdlqgvidhldhl
sklgvnavyftplfkattnhkydtedyfqidpqfgdkdtlkklvdlchergirvlldavf
nhsgrtfppfvdvlkngekskykdwfhirslplevvdgiptydtfafeplmpklntehpd
vkeyllkaaeywiretgidgwrldvanevshqfwrefrrvvkqanpdayilgevwhessi
wlegdqfdavmnypftnavldffihqiadaekfsfmlgkqlagyprqasevmfnlldshd
tarlltqadgdkrkmklavlfqftyfgtpciyygdevgldgghdpgcrkcmewdetkhdk
dlfafyqtvirlrqahaalrtg

Timeline for d1ea9c3:

• d1ea9c3 first appeared in SCOP 1.61
  
• d1ea9c3 appears in SCOPe 2.07