SCOPe 2.08: Domain d1ea9c2: 1ea9 C:504-583

Lineage for d1ea9c2 (1ea9 C:504-583)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
   this domain follows the catalytic beta/alpha barrel domain

6. Protein Maltogenic amylase [51031] (4 species)

7. Species Bacillus sp., cyclomaltodextrinase [TaxId:1409] [75016] (1 PDB entry)

8. Domain d1ea9c2: 1ea9 C:504-583 [70088]
   Other proteins in same PDB: d1ea9c1, d1ea9c3, d1ea9d1, d1ea9d3

Details for d1ea9c2

PDB Entry: 1ea9, 3.2 Å

PDB Description: cyclomaltodextrinase

PDB Compounds: (C:) cyclomaltodextrinase

SCOPe Domain Sequences for d1ea9c2:

Sequence; same for both SEQRES and ATOM records:

>d1ea9c2 b.71.1.1 (C:504-583) Maltogenic amylase {Bacillus sp., cyclomaltodextrinase [TaxId: 1409]}
tfkfltaeknsrqiaylreddqdtilvvmnndkaghtltlpvrhaqwthlwqddvltaah
gqltvklpaygfavlkassd

Timeline for d1ea9c2:

• d1ea9c2 first appeared in SCOP 1.61
  
• d1ea9c2 appears in SCOPe 2.07