Lineage for d1qh0a1 (1qh0 A:9-141)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2402482Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2403031Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families) (S)
  5. 2403099Family b.43.4.2: Ferredoxin reductase FAD-binding domain-like [63381] (10 proteins)
    coupled with a NADP-binding domain of alpha/beta class
  6. 2403127Protein Ferredoxin reductase (flavodoxin reductase) N-terminal domain [50415] (9 species)
  7. Species Anabaena sp., pcc 7119 [TaxId:1167] [50420] (19 PDB entries)
  8. 2403144Domain d1qh0a1: 1qh0 A:9-141 [68891]
    Other proteins in same PDB: d1qh0a2
    complexed with fad, so4; mutant

Details for d1qh0a1

PDB Entry: 1qh0 (more details), 1.93 Å

PDB Description: ferredoxin:nadp+ reductase mutant with leu 76 mutated by asp and leu 78 mutated by asp
PDB Compounds: (A:) protein (ferredoxin:nadp+ reductase)

SCOPe Domain Sequences for d1qh0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qh0a1 b.43.4.2 (A:9-141) Ferredoxin reductase (flavodoxin reductase) N-terminal domain {Anabaena sp., pcc 7119 [TaxId: 1167]}
dvpvnlyrpnapfigkvisneplvkeggigivqhikfdltggnlkyiegqsigiippgvd
kngkpekdrdysiastrhgddvddktislcvrqleykhpesgetvygvcstylthiepgs
evkitgpvgkeml

SCOPe Domain Coordinates for d1qh0a1:

Click to download the PDB-style file with coordinates for d1qh0a1.
(The format of our PDB-style files is described here.)

Timeline for d1qh0a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qh0a2