Lineage for d1kwja_ (1kwj A:)
- Root: SCOP 1.61
Class a: All alpha proteins [46456] (151 folds) 
Fold a.138: Multiheme cytochromes [48694] (1 superfamily) Superfamily a.138.1: Multiheme cytochromes [48695] (3 families) 
Family a.138.1.1: Cytochrome c3-like [48696] (3 proteins) 
Protein Cytochrome c7 (cytochrome c551.5) [48703] (1 species) Species Desulfuromonas acetoxidans [TaxId:891] [48704] (8 PDB entries) 
Domain d1kwja_: 1kwj A: [68877]
Details for d1kwja_
PDB Entry: 1kwj (more details)
PDB Description: solution structure determination of the fully oxidized double mutant k9-10a cytochrome c7 from desulfuromonas acetoxidans, minimized average structure
SCOP Domain Sequences for d1kwja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kwja_ a.138.1.1 (A:) Cytochrome c7 (cytochrome c551.5) {Desulfuromonas acetoxidans}
advvtyenaagnvtfdhkahaeklgcdachegtpakiaidkksahkdacktchksnngpt
kcggchik
SCOP Domain Coordinates for d1kwja_:
Click to download the PDB-style file with coordinates for d1kwja_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1kwja_:
- d1kwja_ first appeared in SCOP 1.59
- d1kwja_ appears in SCOP 1.63
- d1kwja_ appears in the current release, SCOPe 2.08
View in 3D