Lineage for d1kqsa2 (1kqs A:1-90)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1540029Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1541119Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 1541496Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (31 proteins)
    barrel, closed; n=5, S=8
  6. 1541619Protein N-terminal domain of ribosomal protein L2 [50299] (5 species)
    incomplete OB-fold lacking the last strand
  7. 1541657Species Haloarcula marismortui [TaxId:2238] [50301] (40 PDB entries)
    Uniprot P20276
    includes the N-terminal tail
  8. 1541682Domain d1kqsa2: 1kqs A:1-90 [68815]
    Other proteins in same PDB: d1kqs1_, d1kqs2_, d1kqsa1, d1kqsb_, d1kqsc_, d1kqsd_, d1kqse1, d1kqse2, d1kqsf_, d1kqsg_, d1kqsh_, d1kqsi_, d1kqsj_, d1kqsk_, d1kqsl_, d1kqsm_, d1kqsn_, d1kqso_, d1kqsp_, d1kqsq_, d1kqsr_, d1kqss_, d1kqst_, d1kqsu_, d1kqsv_, d1kqsw_, d1kqsx_, d1kqsy_, d1kqsz_
    protein/RNA complex; complexed with aca, btn, cd, cl, k, mg, na, pha, ppu

Details for d1kqsa2

PDB Entry: 1kqs (more details), 3.1 Å

PDB Description: The Haloarcula marismortui 50S Complexed with a Pretranslocational Intermediate in Protein Synthesis
PDB Compounds: (A:) ribosomal protein l2

SCOPe Domain Sequences for d1kqsa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kqsa2 b.40.4.5 (A:1-90) N-terminal domain of ribosomal protein L2 {Haloarcula marismortui [TaxId: 2238]}
grriqgqrrgrgtstfrapshrykadlehrkvedgdviagtvvdiehdparsapvaavef
edgdrrlilapegvgvgdelqvgvdaeiap

SCOPe Domain Coordinates for d1kqsa2:

Click to download the PDB-style file with coordinates for d1kqsa2.
(The format of our PDB-style files is described here.)

Timeline for d1kqsa2: