Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) |
Family c.66.1.18: Mycolic acid cyclopropane synthase [69560] (7 proteins) |
Protein CmaA1 [69561] (1 species) |
Species Mycobacterium tuberculosis [TaxId:1773] [69562] (3 PDB entries) |
Domain d1kpga_: 1kpg A: [68735] complexed with 16a, co3, sah |
PDB Entry: 1kpg (more details), 2 Å
SCOPe Domain Sequences for d1kpga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kpga_ c.66.1.18 (A:) CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} delkphfanvqahydlsddffrlfldptqtyscayferddmtlqeaqiakidlalgklgl qpgmtlldvgcgwgatmmravekydvnvvgltlsknqanhvqqlvansenlrskrvllag weqfdepvdrivsigafehfgherydaffslahrllpadgvmllhtitglhpkeihergl pmsftfarflkfivteifpggrlpsipmvqecasangftvtrvqslqphyaktldlwsaa lqankgqaialqseevyerymkyltgcaemfrigyidvnqftcqk
Timeline for d1kpga_: