Lineage for d1kika_ (1kik A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1535986Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1536113Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 1536114Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 1536395Protein p56-lck tyrosine kinase, SH3 domain [50076] (1 species)
  7. 1536396Species Human (Homo sapiens) [TaxId:9606] [50077] (5 PDB entries)
  8. 1536406Domain d1kika_: 1kik A: [68632]

Details for d1kika_

PDB Entry: 1kik (more details)

PDB Description: sh3 domain of lymphocyte specific kinase (lck)
PDB Compounds: (A:) Proto-oncogene tyrosine-protein kinase LCK

SCOPe Domain Sequences for d1kika_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kika_ b.34.2.1 (A:) p56-lck tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]}
nlvialhsyepshdgdlgfekgeqlrileqsgewwkaqslttgqegfipfnfvakan

SCOPe Domain Coordinates for d1kika_:

Click to download the PDB-style file with coordinates for d1kika_.
(The format of our PDB-style files is described here.)

Timeline for d1kika_: