Class a: All alpha proteins [46456] (179 folds) |
Fold a.25: Ferritin-like [47239] (2 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (2 families) contains dimetal-ion centre in the middle of the bundle |
Family a.25.1.2: Ribonucleotide reductase-like [47253] (5 proteins) |
Protein Ribonucleotide reductase R2 [47257] (6 species) |
Species Corynebacterium ammoniagenes [TaxId:1697] [69006] (3 PDB entries) |
Domain d1kgpc_: 1kgp C: [68594] |
PDB Entry: 1kgp (more details), 2 Å
SCOP Domain Sequences for d1kgpc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kgpc_ a.25.1.2 (C:) Ribonucleotide reductase R2 {Corynebacterium ammoniagenes} sneydeyianhtdpvkainwnvipdekdlevwdrltgnfwlpekipvsndiqswnkmtpq eqlatmrvftgltlldtiqgtvgaisllpdaetmheeavytniafmesvhaksysnifmt lastpqineafrwseenenlqrkakiimsyyngddplkkkvastllesflfysgfylpmy lssrakltntadiirliirdesvhgyyigykyqqgvkklseaeqeeykaytfdlmydlye neieytediyddlgwtedvkrflrynankalnnlgyeglfptdetkvspailssls
Timeline for d1kgpc_: