Lineage for d1kful1 (1kfu L:515-700)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 152429Fold a.39: EF Hand-like [47472] (4 superfamilies)
  4. 152430Superfamily a.39.1: EF-hand [47473] (8 families) (S)
  5. 152779Family a.39.1.7: EF-hand modules in multidomain proteins [47547] (8 proteins)
  6. 152786Protein Calpain large subunit, C-terminal domain (domain IV) [47556] (2 species)
  7. 152787Species Human (Homo sapiens) [TaxId:9606] [47557] (2 PDB entries)
  8. 152788Domain d1kful1: 1kfu L:515-700 [68571]
    Other proteins in same PDB: d1kful2, d1kful3, d1kfus_

Details for d1kful1

PDB Entry: 1kfu (more details), 2.5 Å

PDB Description: Crystal Structure of Human m-Calpain Form II

SCOP Domain Sequences for d1kful1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kful1 a.39.1.7 (L:515-700) Calpain large subunit, C-terminal domain (domain IV) {Human (Homo sapiens)}
eieanleefdiseddiddgvrrlfaqlagedaeisafelqtilrrvlakrqdiksdgfsi
etckimvdmldsdgsgklglkefyilwtkiqkyqkiyreidvdrsgtmnsyemrkaleea
gfkmpcqlhqvivarfaddqliidfdnfvrclvrletlfkifkqldpentgtieldlisw
lcfsvl

SCOP Domain Coordinates for d1kful1:

Click to download the PDB-style file with coordinates for d1kful1.
(The format of our PDB-style files is described here.)

Timeline for d1kful1:

View in 3D
Domains from other chains:
(mouse over for more information)
d1kfus_