Lineage for d1kcka1 (1kck A:496-581)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2765063Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2765186Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (21 proteins)
    domains of unknown function associated with different type of catalytic domains in a different sequential location
    subgroup of the larger IPT/TIG domain family
  6. 2765237Protein Cyclomaltodextrin glycanotransferase, domain D [49215] (4 species)
    follows the starch-binding domain C; the catalytic domain A has (beta/alpha)8-barrel fold; family 13 glycosyl hydrolases
  7. 2765238Species Bacillus circulans, different strains [TaxId:1397] [49216] (36 PDB entries)
  8. 2765261Domain d1kcka1: 1kck A:496-581 [68441]
    Other proteins in same PDB: d1kcka2, d1kcka3, d1kcka4
    complexed with adh, ca, glc; mutant
    has additional insertions and/or extensions that are not grouped together

Details for d1kcka1

PDB Entry: 1kck (more details), 2.43 Å

PDB Description: bacillus circulans strain 251 cyclodextrin glycosyl transferase mutant n193g
PDB Compounds: (A:) cyclodextrin glycosyltransferase

SCOPe Domain Sequences for d1kcka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kcka1 b.1.18.2 (A:496-581) Cyclomaltodextrin glycanotransferase, domain D {Bacillus circulans, different strains [TaxId: 1397]}
tatptighvgpmmakpgvtitidgrgfgsskgtvyfgttavsgaditswedtqikvkipa
vaggnynikvanaagtasnvydnfev

SCOPe Domain Coordinates for d1kcka1:

Click to download the PDB-style file with coordinates for d1kcka1.
(The format of our PDB-style files is described here.)

Timeline for d1kcka1: