Lineage for d1kbla3 (1kbl A:2-376)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 418907Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 418908Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (7 families) (S)
  5. 419081Family d.142.1.5: Pyruvate phosphate dikinase, N-terminal domain [56085] (1 protein)
  6. 419082Protein Pyruvate phosphate dikinase, N-terminal domain [56086] (2 species)
    the common fold is interrupted by a 4-helical subdomain (residues 112-198)
  7. 419083Species Clostridium symbiosum [TaxId:1512] [56087] (6 PDB entries)
  8. 419084Domain d1kbla3: 1kbl A:2-376 [68386]
    Other proteins in same PDB: d1kbla1, d1kbla2
    complexed with nh4, so4

Details for d1kbla3

PDB Entry: 1kbl (more details), 1.94 Å

PDB Description: pyruvate phosphate dikinase

SCOP Domain Sequences for d1kbla3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kbla3 d.142.1.5 (A:2-376) Pyruvate phosphate dikinase, N-terminal domain {Clostridium symbiosum}
akwvykfeegnasmrnllggkgcnlaemtilgmpipqgftvtteacteyynsgkqitqei
qdqifeaitwleelngkkfgdtedpllvsvrsgarasmpgmmdtilnlglndvavegfak
ktgnprfaydsyrrfiqmysdvvmevpkshfekiidamkeekgvhfdtdltaddlkelae
kfkavykeamngeefpqepkdqlmgavkavfrswdnpraivyrrmndipgdwgtavnvqt
mvfgnkgetsgtgvaftrnpstgekgiygeylinaqgedvvagvrtpqpitqlendmpdc
ykqfmdlamklekhfrdmqdmeftieegklyflqtrngkrtapaalqiacdlvdegmite
eeavvrieaksldql

SCOP Domain Coordinates for d1kbla3:

Click to download the PDB-style file with coordinates for d1kbla3.
(The format of our PDB-style files is described here.)

Timeline for d1kbla3: