Lineage for d1k9vf_ (1k9v F:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1356042Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1358417Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) (S)
    conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures
  5. 1358418Family c.23.16.1: Class I glutamine amidotransferases (GAT) [52318] (12 proteins)
    contains a catalytic Cys-His-Glu triad
  6. 1358493Protein GAT subunit, HisH, (or domain) of imidazoleglycerolphosphate synthase HisF [69447] (3 species)
  7. 1358503Species Thermotoga maritima [TaxId:2336] [69448] (5 PDB entries)
  8. 1358507Domain d1k9vf_: 1k9v F: [68365]
    complexed with acy

Details for d1k9vf_

PDB Entry: 1k9v (more details), 2.4 Å

PDB Description: Structural evidence for ammonia tunelling across the (beta-alpha)8-barrel of the imidazole glycerol phosphate synthase bienzyme complex
PDB Compounds: (F:) amidotransferase hish

SCOPe Domain Sequences for d1k9vf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k9vf_ c.23.16.1 (F:) GAT subunit, HisH, (or domain) of imidazoleglycerolphosphate synthase HisF {Thermotoga maritima [TaxId: 2336]}
mrigiisvgpgnimnlyrgvkrasenfedvsielvesprndlydllfipgvghfgegmrr
lrendlidfvrkhvederyvvgvclgmqllfeeseeapgvkglsliegnvvklrsrrlph
mgwnevifkdtfpngyyyfvhtyravceeehvlgtteydgeifpsavrkgrilgfqfhpe
ksskigrkllekviecslsr

SCOPe Domain Coordinates for d1k9vf_:

Click to download the PDB-style file with coordinates for d1k9vf_.
(The format of our PDB-style files is described here.)

Timeline for d1k9vf_: