Lineage for d1k9ih_ (1k9i H:)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 198738Fold d.169: C-type lectin-like [56435] (1 superfamily)
  4. 198739Superfamily d.169.1: C-type lectin-like [56436] (6 families) (S)
  5. 198740Family d.169.1.1: C-type lectin domain [56437] (18 proteins)
  6. 198750Protein DC-SIGN (dendritic cell-specific ICAM-3 grabbing nonintegrin) [69855] (1 species)
  7. 198751Species Human (Homo sapiens) [TaxId:9606] [69856] (1 PDB entry)
  8. 198759Domain d1k9ih_: 1k9i H: [68350]

Details for d1k9ih_

PDB Entry: 1k9i (more details), 2.5 Å

PDB Description: complex of dc-sign and glcnac2man3

SCOP Domain Sequences for d1k9ih_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k9ih_ d.169.1.1 (H:) DC-SIGN (dendritic cell-specific ICAM-3 grabbing nonintegrin) {Human (Homo sapiens)}
pcpwewtffqgncyfmsnsqrnwhdsitackevgaqlvviksaeeqnflqlqssrsnrft
wmglsdlnqegtwqwvdgspllpsfkqywnrgepnnvgeedcaefsgngwnddkcnlakf
wickksa

SCOP Domain Coordinates for d1k9ih_:

Click to download the PDB-style file with coordinates for d1k9ih_.
(The format of our PDB-style files is described here.)

Timeline for d1k9ih_: