Lineage for d1k98a1 (1k98 A:651-740)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1271519Fold a.46: Methionine synthase domain-like [47643] (3 superfamilies)
    4 helices; bundle, left-handed twist; right-handed superhelix
  4. 1271520Superfamily a.46.1: Methionine synthase domain [47644] (1 family) (S)
    automatically mapped to Pfam PF02607
  5. 1271521Family a.46.1.1: Methionine synthase domain [47645] (1 protein)
  6. 1271522Protein Methionine synthase domain [47646] (1 species)
  7. 1271523Species Escherichia coli [TaxId:562] [47647] (5 PDB entries)
  8. 1271529Domain d1k98a1: 1k98 A:651-740 [68338]
    Other proteins in same PDB: d1k98a2, d1k98a3
    complexed with b12, so4

Details for d1k98a1

PDB Entry: 1k98 (more details), 3.75 Å

PDB Description: adomet complex of meth c-terminal fragment
PDB Compounds: (A:) methionine synthase

SCOPe Domain Sequences for d1k98a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k98a1 a.46.1.1 (A:651-740) Methionine synthase domain {Escherichia coli [TaxId: 562]}
qaewrswevnkrleyslvkgitefieqdteearqqatrpieviegplmdgmnvvgdlfge
gkmflpqvvksarvmkqavaylepfieask

SCOPe Domain Coordinates for d1k98a1:

Click to download the PDB-style file with coordinates for d1k98a1.
(The format of our PDB-style files is described here.)

Timeline for d1k98a1: