Lineage for d1k83h_ (1k83 H:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1540029Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1541119Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 1542057Family b.40.4.8: RNA polymerase subunit RBP8 [50321] (1 protein)
    duplication; contains tandem repeat of two incomplete OB-folds; forms a single barrel; n=8, S=10
    automatically mapped to Pfam PF03870
  6. 1542058Protein RNA polymerase subunit RBP8 [50322] (2 species)
  7. 1542059Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [50323] (35 PDB entries)
    Uniprot P20436
  8. 1542063Domain d1k83h_: 1k83 H: [68282]
    Other proteins in same PDB: d1k83a_, d1k83b_, d1k83c1, d1k83c2, d1k83e1, d1k83e2, d1k83f_, d1k83i1, d1k83i2, d1k83j_, d1k83k_, d1k83l_
    protein/DNA complex; protein/RNA complex; complexed with mn, zn

Details for d1k83h_

PDB Entry: 1k83 (more details), 2.8 Å

PDB Description: Crystal Structure of Yeast RNA Polymerase II Complexed with the Inhibitor Alpha Amanitin
PDB Compounds: (H:) DNA-directed RNA polymerase II 14.5kd polypeptide

SCOPe Domain Sequences for d1k83h_:

Sequence, based on SEQRES records: (download)

>d1k83h_ b.40.4.8 (H:) RNA polymerase subunit RBP8 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sntlfddifqvsevdpgrynkvcrieaasttqdqckltldinvelfpvaaqdsltvtias
slnledtpandssatrswrppqagdrsladdydyvmygtaykfeevskdliavyysfggl
lmrlegnyrnlnnlkqenayllirr

Sequence, based on observed residues (ATOM records): (download)

>d1k83h_ b.40.4.8 (H:) RNA polymerase subunit RBP8 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sntlfddifqvsevdpgrynkvcrieaasttqdqckltldinvelfpvaaqdsltvtias
sltrswrppqagdrsladdydyvmygtaykfeevskdliavyysfggllmrlegnyrnln
nlkqenayllirr

SCOPe Domain Coordinates for d1k83h_:

Click to download the PDB-style file with coordinates for d1k83h_.
(The format of our PDB-style files is described here.)

Timeline for d1k83h_: