Lineage for d1k83f_ (1k83 F:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1284114Fold a.143: RPB6/omega subunit-like [63561] (1 superfamily)
    core: 2 helices and adjacent loops
  4. 1284115Superfamily a.143.1: RPB6/omega subunit-like [63562] (2 families) (S)
    the bacterial omega and eukaryotic RPB6 subunits both function in polymerase assembly; the common core is involved in conserved interactions with other subunits
  5. 1284155Family a.143.1.2: RPB6 [55294] (1 protein)
  6. 1284156Protein RPB6 [55295] (3 species)
    essential subunit of RNA polymerases I, II and III
  7. 1284157Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64318] (30 PDB entries)
    Uniprot P20435; part of multichain biological unit
  8. 1284161Domain d1k83f_: 1k83 F: [68281]
    Other proteins in same PDB: d1k83a_, d1k83b_, d1k83c1, d1k83c2, d1k83e1, d1k83e2, d1k83h_, d1k83i1, d1k83i2, d1k83j_, d1k83k_, d1k83l_
    protein/DNA complex; protein/RNA complex; complexed with mn, zn

Details for d1k83f_

PDB Entry: 1k83 (more details), 2.8 Å

PDB Description: Crystal Structure of Yeast RNA Polymerase II Complexed with the Inhibitor Alpha Amanitin
PDB Compounds: (F:) DNA-directed RNA polymerase II 23kd polypeptide

SCOPe Domain Sequences for d1k83f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k83f_ a.143.1.2 (F:) RPB6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kaipkdqrattpymtkyerarilgtralqismnapvfvdlegetdplriamkelaekkip
lvirrylpdgsfedwsveelivdl

SCOPe Domain Coordinates for d1k83f_:

Click to download the PDB-style file with coordinates for d1k83f_.
(The format of our PDB-style files is described here.)

Timeline for d1k83f_: