Class a: All alpha proteins [46456] (284 folds) |
Fold a.143: RPB6/omega subunit-like [63561] (1 superfamily) core: 2 helices and adjacent loops |
Superfamily a.143.1: RPB6/omega subunit-like [63562] (2 families) the bacterial omega and eukaryotic RPB6 subunits both function in polymerase assembly; the common core is involved in conserved interactions with other subunits |
Family a.143.1.2: RPB6 [55294] (1 protein) |
Protein RPB6 [55295] (3 species) essential subunit of RNA polymerases I, II and III |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64318] (30 PDB entries) Uniprot P20435; part of multichain biological unit |
Domain d1k83f_: 1k83 F: [68281] Other proteins in same PDB: d1k83a_, d1k83b_, d1k83c1, d1k83c2, d1k83e1, d1k83e2, d1k83h_, d1k83i1, d1k83i2, d1k83j_, d1k83k_, d1k83l_ protein/DNA complex; protein/RNA complex; complexed with mn, zn |
PDB Entry: 1k83 (more details), 2.8 Å
SCOPe Domain Sequences for d1k83f_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k83f_ a.143.1.2 (F:) RPB6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} kaipkdqrattpymtkyerarilgtralqismnapvfvdlegetdplriamkelaekkip lvirrylpdgsfedwsveelivdl
Timeline for d1k83f_: