Lineage for d1k4db2 (1k4d B:108-212)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2748802Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species)
  7. 2749038Species Mouse (Mus musculus) [TaxId:10090] [88567] (374 PDB entries)
    Uniprot P01837# KAC_MOUSE Ig kappa chain C region; 99% sequence identity ! SQ NA # natural chimera; best hits are: Uniprot P01637 (Ig kappa chain V-V region T1) and Uniprot P01837 (Ig kappa chain C region) ! Uniprot P01837 # KAC_MOUSE Ig kappa chain C region ! Uniprot P01837 # KAC_MOUSE (P01837) Ig kappa chain C region ! SQ NA # part of Fab 28 against HIV-1 RT ! Uniprot P01837 # ! KAC_MOUSE Ig kappa chain C region
  8. 2749165Domain d1k4db2: 1k4d B:108-212 [68134]
    Other proteins in same PDB: d1k4da1, d1k4da2, d1k4da3, d1k4db1, d1k4dc_
    part of Fab against potassium channel KcsA
    complexed with dga, f09, k, na

Details for d1k4db2

PDB Entry: 1k4d (more details), 2.3 Å

PDB Description: potassium channel kcsa-fab complex in low concentration of k+
PDB Compounds: (B:) antibody fab fragment light chain

SCOPe Domain Sequences for d1k4db2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k4db2 b.1.1.2 (B:108-212) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrn

SCOPe Domain Coordinates for d1k4db2:

Click to download the PDB-style file with coordinates for d1k4db2.
(The format of our PDB-style files is described here.)

Timeline for d1k4db2: