SCOP 1.65: Domain d1k3fa_: 1k3f A:

Lineage for d1k3fa_ (1k3f A:)

1. Root: SCOP 1.65

2. Class c: Alpha and beta proteins (a/b) [51349] (121 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (6 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.2: Purine and uridine phosphorylases [53167] (1 family)
   complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8

5. Family c.56.2.1: Purine and uridine phosphorylases [53168] (4 proteins)

6. Protein Uridine phosphorylase [53176] (1 species)

7. Species Escherichia coli [TaxId:562] [53177] (3 PDB entries)

8. Domain d1k3fa_: 1k3f A: [68105]

Details for d1k3fa_

PDB Entry: 1k3f, 2.5 Å

PDB Description: Uridine Phosphorylase from E. coli, Refined in the Monoclinic Crystal Lattice

SCOP Domain Sequences for d1k3fa_:

Sequence; same for both SEQRES and ATOM records:

>d1k3fa_ c.56.2.1 (A:) Uridine phosphorylase {Escherichia coli}
msksdvfhlgltkndlqgatlaivpgdpdrvekiaalmdkpvklashrefttwraeldgk
pvivcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgas
lhfaplefpavadfecttalveaaksigatthvgvtassdtfypgqerydtysgrvvrhf
kgsmeewqamgvmnyemesatlltmcasqglragmvagvivnrtqqeipnaetmkqtesh
avkivveaarrll

Timeline for d1k3fa_:

• d1k3fa_ first appeared in SCOP 1.59
  
• d1k3fa_ appears in SCOP 1.63
  
• d1k3fa_ appears in SCOP 1.67
  
• d1k3fa_ appears in the current release, SCOPe 2.08